PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g025740.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HB-other
Protein Properties Length: 149aa    MW: 17231.9 Da    PI: 10.3652
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g025740.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.51.7e-112277156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++kR ++t eq+++ +++ +k+++p++++  ++++++gL+ +++k+W  N +++ek
  Solyc04g025740.1.1 22 KKKRFRLTVEQIQQVKDFLKKCPHPDKDQLIQISEEVGLKPKKIKNWIYNNKTQEK 77
                        79**************************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-13860IPR009057Homeodomain-like
PROSITE profilePS5007112.3091979IPR001356Homeobox domain
SuperFamilySSF466891.59E-122084IPR009057Homeodomain-like
SMARTSM003893.4E-72183IPR001356Homeobox domain
CDDcd000862.04E-82279No hitNo description
PfamPF000465.2E-92277IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-561107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MTNVGKKHVG ESSTSQNKAN KKKKRFRLTV EQIQQVKDFL KKCPHPDKDQ LIQISEEVGL  60
KPKKIKNWIY NNKTQEKIQV EKSANKTLRT ENEKLRSENM AMKEAMKKII CPQCDSERAS  120
NLENLKAENQ RLTDKILWYS ILLGGENF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109308e-10Solanum lycopersicum DNA, chromosome 8, clone: C08SLe0034G06, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341852.16e-80PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X2
TrEMBLK4BR181e-105K4BR18_SOLLC; Uncharacterized protein
STRINGSolyc04g025740.1.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2751622
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.16e-29homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]